SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016368 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016368
Domain Number 1 Region: 188-270
Classification Level Classification E-value
Superfamily F-box domain 3.14e-17
Family F-box domain 0.003
Further Details:      
 
Domain Number 2 Region: 97-128
Classification Level Classification E-value
Superfamily MIT domain 0.0000327
Family MIT domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016368   Gene: ENSOARG00000015254   Transcript: ENSOART00000016603
Sequence length 452
Comment pep:known_by_projection chromosome:Oar_v3.1:20:25069052:25089430:1 gene:ENSOARG00000015254 transcript:ENSOART00000016603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAESPSAAAGRPASMAEAEEDCRSEAVREGDDDDENESPAETDLQAQLQRFRAQWMFEL
APGGGSGNLESRPCRAARGSLLRAGDTRGKQELAKEEKARELFLKAVEEEQNGALYEAIK
FYRRAMQLVPDIEFKITYTRSPDGDGVGNSYIEDTDDDSKMADLLSYFQQQLTFQESVLK
LCQPELESSQTHISALPMEVLMYVFRWVVSSDLDLRSLEQLSQVCRGFYICARDPEIWRL
ACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVE
YYRYVRFFPDGHVMMLTTPEEPPSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVI
TKKKEEKALDHKYRYFRRAPVQEADQNFHVGLQLCSSGHQSFNKLIWIHHSCHITYKSTG
ETAVTAFEIDKMYTPLLFARVRSYTAFSERPL
Download sequence
Identical sequences W5Q0Y2
ENSOARP00000016368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]