SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016411 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016411
Domain Number 1 Region: 136-307
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.8e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000654
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016411   Gene: ENSOARG00000015296   Transcript: ENSOART00000016646
Sequence length 338
Comment pep:known_by_projection chromosome:Oar_v3.1:1:129008749:129024670:1 gene:ENSOARG00000015296 transcript:ENSOART00000016646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEAMAVVVWGLRLWRAAPGGGAAWRSVATSPASQLSPTELIQMQNDLFNKEKNRQLSLTP
RTEKIEVKHVGKTDPGTIFVLNKNVSTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDDDPGEVNKAYWRSCAMIMGCVIERAFKDEYVVHLVRAPEVPVIAGAFC
YDVVLDKRLDEWMPTKENLRSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKVDFI
EEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNIQATQSSLVRRFQGL
SLPAHLRAHFTIWNKLLERSQKMVTEDQTKPTEKSAST
Download sequence
Identical sequences W5Q125
ENSOARP00000016411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]