SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016460 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016460
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 62-139
Classification Level Classification E-value
Superfamily F-box domain 5.76e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016460   Gene: ENSOARG00000015344   Transcript: ENSOART00000016695
Sequence length 319
Comment pep:known_by_projection chromosome:Oar_v3.1:2:105390274:105423924:1 gene:ENSOARG00000015344 transcript:ENSOART00000016695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVARNQQLQQEGYGEQGYFSREQSRRVAASNMSHTSHRKHVQGGIDIYHLLKTR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences W5Q174
ENSOARP00000016460 XP_004004503.1.66739 XP_011984646.1.66739 XP_012015727.1.54773 XP_012015728.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]