SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016461 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016461
Domain Number 1 Region: 407-431
Classification Level Classification E-value
Superfamily Notch domain 0.0000667
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000016461
Domain Number - Region: 929-1001
Classification Level Classification E-value
Superfamily EF-hand 0.00614
Family Parvalbumin 0.053
Further Details:      
 
Domain Number - Region: 470-497
Classification Level Classification E-value
Superfamily Notch domain 0.0106
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016461   Gene: ENSOARG00000015343   Transcript: ENSOART00000016696
Sequence length 1211
Comment pep:known_by_projection chromosome:Oar_v3.1:3:170615182:170667987:-1 gene:ENSOARG00000015343 transcript:ENSOART00000016696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMSREILGKNTTEPTKKSEKPLECLLTHCIKVPMLVLDPALPTNITLKDLPSLY
PSFHSASDVFNVAKPKNPSTNVSVVVFDTTKNVEDAQAGMFKGNSRQTVWRGYLTTDKEV
PGLVLMQDLAFLSGFPPTFKETNQLKAKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQ
ELNKQTKKNMTINGKELTISPAYLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIER
HAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGL
SQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNN
SACDWDGGDCSGNSGASRYIAGAGGTGSIGVGQPWHFGAGMTGVSYCNQGCANSWLADKF
CDQACNVLSCGFDAGDCGQDHFHELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKKGIEG
AYSDNPIIRHASIANKWKTIHLLMHSGMNATTIHFNLTLQGKNDEEFKIQIVVEVDTREE
PKRNSTTQKAYHSLMSSTTLHPEAEILFEDIPEEKRFPKVKRHDVNTTRRFQVEVEIPQV
NISLLPKETQLSLNNLDLQLERGDITMKGYNLSKSALLRSFLMNPQNGKLTVNHPLTTEQ
RNGGLEAPLAKQVHRSNLGTSERLQESSPFPAVTVTVNNHSQSQIPPLGARFRAITVTPK
AGDRNVSREKLSSLTFPLESKDTQEKVITGKEQERKTEGNANSYPGGNEVVPGRKLQHYT
DSYLGFLPWEKKKYFQDLLDEEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSK
FGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAV
QPLNISQVFDEVDTDQSGILSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANI
TQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKM
IRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELP
REYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTVFSFFAEQLIALKRKIFPRRRI
HKEASPDRIRV
Download sequence
Identical sequences W5Q175
ENSOARP00000016461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]