SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016532 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016532
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000192
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016532   Gene: ENSOARG00000015412   Transcript: ENSOART00000016768
Sequence length 97
Comment pep:known_by_projection chromosome:Oar_v3.1:11:48377004:48377962:1 gene:ENSOARG00000015412 transcript:ENSOART00000016768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLYITPDGFFFRVHILALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQILR
GRLRPGDGLLRSSSSYVKRFNRKRDGQVQGAIHAQCI
Download sequence
Identical sequences L8J1Y4 W5Q1E6
ENSOARP00000016532 XP_004013085.1.66739 XP_005887825.1.15283 XP_005976240.1.78601 XP_005976241.1.78601 XP_006049510.1.26621 XP_010854704.1.44457 XP_011986360.1.54773 XP_014334534.1.15283 XP_017920868.1.57651 XP_020762925.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]