SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016542 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016542
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.14e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000221
Further Details:      
 
Domain Number 2 Region: 126-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000437
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.33e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016542   Gene: ENSOARG00000015422   Transcript: ENSOART00000016778
Sequence length 613
Comment pep:known_by_projection chromosome:Oar_v3.1:X:108316770:108344828:-1 gene:ENSOARG00000015422 transcript:ENSOART00000016778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLAPLVRTVCVRGPRQRNRLPGNLFQRWHVPLELQMTRQMASSGPS
GGKIDNSVLVLIVGLSTIGAGAYAYKTLKDDKKRYNERISGLGLTPEEKQKRATSSALEG
EPQPQVRIPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHVENGGVAVLTGKKVVQLDVRG
NVAKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIEDFRTLEKISREV
KSITIIGGGFLGSELACALGRKARASGTEVIQLFPEKGNMGKVLPEYLSNWTMEKVRREG
VKVLPSAIVQSVGVSSGRLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASD
IPVPPSNPAVPQVPTQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences W5Q1F6
XP_004022429.1.66739 XP_012014869.1.54773 ENSOARP00000016542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]