SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016704 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016704
Domain Number 1 Region: 6-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-82
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 317-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-21
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 3 Region: 467-540
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000236
Family Spermadhesin, CUB domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016704   Gene: ENSOARG00000015570   Transcript: ENSOART00000016942
Sequence length 560
Comment pep:known_by_projection chromosome:Oar_v3.1:15:44494449:44517443:1 gene:ENSOARG00000015570 transcript:ENSOART00000016942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHISKKKLILLFGIVFLEQSKSATLSLPKVPTCGQSPVKSQSLNYLNIFSRIVGGRQVAK
GSYPWQVSLKRRQKHVCGGTIISPQWVITAAHCVANRNTVSTFNVTAGEYDLRHVEPGEQ
TLTIETIIIHPHFTTKKPMDYDIALLKMAGAFHFDQFVGPMCLPEPGERFKPGFICTTAG
WGRLNENGISPQVLQEVNLPILTQDECITALLTLEKPISGRTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGTWTMAGVTSWGLGCGRGWKDNLQKNDQGSPGIFTDLTKVLSWIHKHIRI
GKQRKSSRATCSEQDRVVRASEGELHFPESPFLYYESKQHCAWTLLVPEEMHVLLSFSYF
DAESCDHNYLSIYSLEDTLIAKFCGERLASSVLVGSSAIRLNFISDNTDYAVGFNLTYKA
VKPNYLPAFDCGVLDICFYACSLNTSVLSADVPSGRWYCSQGKKYFELSLSFQDLKIEEN
GDCTSDYVSVHRDVERKKEIARLCGFLVPTPVVSITRVMSISFQSNENATFRGFQATVSF
IHEKDFNISGLENESVFLET
Download sequence
Identical sequences W5Q1W6
ENSOARP00000016704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]