SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016709 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016709
Domain Number 1 Region: 432-650
Classification Level Classification E-value
Superfamily TPR-like 5.31e-33
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 665-806
Classification Level Classification E-value
Superfamily TPR-like 1.22e-22
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000016709
Domain Number - Region: 184-253
Classification Level Classification E-value
Superfamily SIS domain 0.0289
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016709   Gene: ENSOARG00000015575   Transcript: ENSOART00000016947
Sequence length 920
Comment pep:known_by_projection chromosome:Oar_v3.1:3:124340397:124376213:1 gene:ENSOARG00000015575 transcript:ENSOART00000016947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLMEKMADINLKEVTLIVGVVAVCYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQND
FWGTPMSEERSHKSYRPLTVLTFRLNYLFSELTPMSYHLLNMIFHAVVSVIFLKVCRLFL
NNQSSMIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIA
LTVFLVAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQT
LIKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLL
NPSELCCDWTMGTIPLIESFLDVRNLATFIFFCFLGALGVFSLRYPSNSSKTVLMALCLM
ALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVFKKLSWVCLSLVIF
THALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHV
QPDDIGAHMNVGRTYKNLNRTKEAEESYMTAKSLMPQIIPGKKYAARIAPNHLNVYINLA
NLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPIKAKEAYLKALELDRN
NADLWYNLAIVHIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVRLRPEARK
RLLSYINEEPQDANGYFNLGMLAMDDKKDSEAEIWMKKAIKLQADFRSALFNLALLYSQT
AKELMALPVLEELLKYYPDHIKGLILKGDILMNQKKDIRGAKKCFEKILEMDPGNVQGKH
NLCVVYFEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSSFVEQPIFPAGKTS
GVEGDKIPTENVKEIKSEPRPTQIIKTNDNKSQSKASKQLGKSTDKEIPHKTTKEIKEIE
KKRVAALKRLEEIERILNGE
Download sequence
Identical sequences W5Q1X1
ENSOARP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]