SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016712 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016712
Domain Number 1 Region: 44-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-31
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 256-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 447-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 161-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 408-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 209-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 371-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016712   Gene: ENSOARG00000015579   Transcript: ENSOART00000016950
Sequence length 857
Comment pep:known_by_projection chromosome:Oar_v3.1:9:72670390:72737660:1 gene:ENSOARG00000015579 transcript:ENSOART00000016950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSALAGGFFTTEPPGRSLINNKGNGALAEHSENVHISGVSTACGETPEQIRAPSGIITS
PGWPSEYPARINCSWFIRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYRACG
STIPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPAAW
KCNNMDECGDSSDEEICAREANPPTSASFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNI
DCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTD
FKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAAR
GFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTVCQKEEFPCSRN
GVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEE
NCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRR
EAPPSYGQLIAQGLIPPVEDFPVCSPNQQASVLENLRLAVRSQLGFTSIRLPMAGRSSNI
WNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERR
DTAGASGGVAAPLPQKVPPTTAVEATVGASGSSSTQSTRGGHTETGRDVTGVEPPSVSPA
RHQLTSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGVNGREEDDDVEMLIPVSEG
ASDFDVSDCSRPLLDLPSDQGQGFRQPYSGTNPGVRPSSRDGPCERCGIVHTAQIPDSCL
EATLKTETSDDEALLLC
Download sequence
Identical sequences W5Q1X4
ENSOARP00000016712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]