SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016824 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016824
Domain Number 1 Region: 146-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 302-415
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-33
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 3 Region: 463-571
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.32e-20
Family Frizzled cysteine-rich domain 0.00075
Further Details:      
 
Domain Number 4 Region: 260-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 419-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016824   Gene: ENSOARG00000015673   Transcript: ENSOART00000017062
Sequence length 574
Comment pep:novel chromosome:Oar_v3.1:15:29391728:29396511:-1 gene:ENSOARG00000015673 transcript:ENSOART00000017062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDCSDIVVCVETTELSKTEFCNPAFEPESGPSCPLPALREDANCSARAPWQGRHPRRLQ
PDCHFSWLCVLLLAGLLLLLLGLLVAIILAQLQATAPPGATYRPLPSRGLATTGTTPATS
TTTSQATGTPKRQPEAGVSLAPQSACGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVDT
DHAIQLKIETLSMESVASCLFDRLEISPEPEGPLLRVCGRVPPPTFNTNASRLRLAFVSD
SSVEGSGFHAWYQAVAPGHGSCAHEEFPCDQFVCLLRDSVCDGFANCADGSDETNCSAKF
SGCGGNLTGLEGTFSAPSYLQQYPHQQLCTWHISVPAGHGVELLFHNFSLEAQDECKSDY
VEVYEAHNSGALSLLDRFCGAEPPPRLISSHHQLAVLFRTDHGFSVGGFSATYRALNATE
SPCRPGEFSCQDGGCKSLQWMCSTWRDCANDNCSSPLFPPPELACEPVQVEMCVGLSYNT
TALEGTWGAGCLRAPLFLPQSLTSLPCYQKFRRLLCGLLVPHCTPLGSVLPPCRSVCQEA
ERQCQSGLVLLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences W5Q286
ENSOARP00000016824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]