SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016901 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016901
Domain Number 1 Region: 3954-4324
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-101
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 2 Region: 4461-4792
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-88
Family Hect, E3 ligase catalytic domain 0.0000392
Further Details:      
 
Domain Number 3 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 4 Region: 2963-3254
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.27e-61
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 5 Region: 2732-2914
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2557-2634
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 3205-3328
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.66e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1866-1932
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1207-1291
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.000000000000113
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000016901
Domain Number - Region: 2463-2509
Classification Level Classification E-value
Superfamily UBA-like 0.00111
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3621-3711
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0314
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016901   Gene: ENSOARG00000015710   Transcript: ENSOART00000017140
Sequence length 4838
Comment pep:known_by_projection chromosome:Oar_v3.1:2:112478388:112720769:-1 gene:ENSOARG00000015710 transcript:ENSOART00000017140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLAAQTRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELSQNGELPP
RKDDGVDTQIGTKKEDLNDKEKKEEEETPAPAYRAKSILESWVWGQQPDVNELKECLSVL
VKEQQALAIQSATTTLSALRLKQRLIVLERYFIALNRTVFQENVKVKWKSSNISLPPVDK
KSSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQ
RGALSQMLSAVLLLLHLWDSGAQETDNERSAQGTSAPLLPLLQRFRSIICSKDAPCAEGD
SHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPSALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMTVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVALASSAGVLSTVQAAAQAVLQSGWSVLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGENIGQTSEVSS
PELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGDFTGILLPELVV
SIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDLEELAWPGIMESFFTGQ
NCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFVGEDPVV
ALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCS
HRQALGDHAQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWKRIAQKIIRERRKKRD
IVPKKPESTDEEEKIGNGESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVTGVH
KYKWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILK
LAAKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYT
WAVQNIRNVLIDANAKFKELGIQPVPLQTITNENPSGPSLGTTPQARFLLVMLSMLTLQH
GAHNLSLLLNSGTLALTQTALRLIGPSCDNVEEDMNASARGASATVLEETRKETAPVQLP
VSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYR
MGKEGKYDLKLAELPVSTQPSAEDSDTEDDSEAEQIERNIHPTAMMLTSTVNLLQTLCLS
AGVHAEVMQSEATKTLCGLLRMLVESGTTDKTSSPSRLVCREQHRSWCTLGFVRSIALTP
HMCAALSSPPWISLLMKVVEGHSPFTAASLQRQILAVHLLQAVLPSWDKTERARDMECLV
EKLFGFLGSLLTTCSSDVPFLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLHSLG
QWNGLINKYINSQLHSVTRSCAGKLAEGALLDDFFPDCENPEVGSLMAVLAVIGGIDGRL
RLGGQVMHDDFGEGTVTRITPKGKITVQFCDLRTCRVCPLNQLKPLPAVAFSVTNLPFTE
PMLSVWAQLVNLAGSKLEKHKIKKSPKQGFAGQVDLDLLRRQQLKLYVLKAGRALLSHQD
QLRQILSQPAVQEAAAAHTDDGAAVSPDLVDMSPEGPQPPMILLQQLLASATQPSPVKAI
FDKQELEAAALAVCQCLAVESTHPLSPVFEDCSSSEATTPVPVQHIRPVRAKKHKQSPGP
VLPVVVQLMEMGFPRRNIEFALKSLTGASGNAAGLPGVEALVGWLLDHADVQVTDLSDAD
TGSEECSDEEVVEDVDDTAYAMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMV
RCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSPS
HIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEME
LVPSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCEACFKTRKHNTRHTFGRINEPGQSA
IFCGRSGKQLKRCHNSQPGMLLDSWARMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGK
HWIRLEVFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVSL
LNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEK
GNSGSLIRRKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQV
AGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGR
HATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSS
GELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSW
GDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRL
GHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTVN
RKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSD
ADSSPASNKINGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDTVVGAL
MPAGMVAPVECPSFSSAPPSDVSAMASPMNGEECVLAVDIEDRLSPNPWQEKRGEIISSE
DAVTPSAVTPSACSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPELQSLDE
FTSLLVVDDTRVLVDLLKLSVCGRAGDKGRDVLSAVLSGMGTAYPQVADMLLELCVTELE
DVATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDPLT
VMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPK
DLLSDRCVLSCPSMDLVTCLLDFRLNLASHRSIIPRLAASLAACAQLSALAASHRMWALQ
RLRKLLTTEFGQSININRLLGDNDGETRALSFSGSALAALVKGLPEALQRQFEYEDPIVR
GGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTSLPRL
FLDEVAKKIRELMADGENMDVLHESHSIFRREQDEQLVQWMNRRPDDWTLSAGGSGTIYG
WGHNHRGQLGGIEGAKVKVPTPCEALAALRPVQLIGGEQTLFAVTADGKLYATGYGAGGR
LGVGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNR
SPCDRPRVIESLRGTEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKL
VEALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTG
LGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIAT
GSLHCVCCSEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAW
STSKPASAGKLPVQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDET
GLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAG
PDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNG
LTPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGIAIRTGSPLSLNLAE
PVWKQLAGMNLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLS
SKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCG
SPDIPLHLLKSVATYKGVEPSAPLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADF
RGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDY
ARIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences W5Q2G3
ENSOARP00000016901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]