SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017089 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017089
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.61e-30
Family Retrovirus capsid protein, N-terminal core domain 0.0075
Further Details:      
 
Domain Number 2 Region: 168-248
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.54e-23
Family Retrovirus capsid protein C-terminal domain 0.00089
Further Details:      
 
Domain Number 3 Region: 316-366
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000317
Family Retroviral protease (retropepsin) 0.0031
Further Details:      
 
Domain Number 4 Region: 262-309
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000244
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017089   Gene: ENSOARG00000015918   Transcript: ENSOART00000017330
Sequence length 368
Comment pep:novel chromosome:Oar_v3.1:18:26350193:26352310:1 gene:ENSOARG00000015918 transcript:ENSOART00000017330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERVKKAASKRKCFVDPPRLFPIIRQHDARAGMINVQYMPLEYKFFKDLKAAVSQYGPQS
PFVLSMLENVGTSKLILPLDWESIAQAVLEGSQWLQLRSWWEEEARKQARINEGQNPQGP
LEDKLMGEGQYRALREQVQYTDQELQKVRQVFLRAWRRVVPTGQAQPSFVKTIQGPNEPY
TDFLARLRVAIERTVGRDEISKILLDTLAYENANPECKRILGPLKGQGASVAEFIRACSG
VGGAEHQASVFAAALAKAVKPQRGGNCFNCGKPGHFQKDCKRRRKKRQPLGLCRRCGKGK
HWTQECKSKTDREMLINDSRPLMSLIIEGIQFEGLVDTGADVSVISLQQWPNDWKKEKIP
LVLTGLGS
Download sequence
Identical sequences W5Q301
ENSOARP00000017089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]