SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017130 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017130
Domain Number 1 Region: 292-605
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 8.24e-40
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 708-877
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-27
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 90-212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1014-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000017130
Domain Number - Region: 60-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0232
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017130   Gene: ENSOARG00000015949   Transcript: ENSOART00000017371
Sequence length 1218
Comment pep:known_by_projection chromosome:Oar_v3.1:22:34507410:35311829:1 gene:ENSOARG00000015949 transcript:ENSOART00000017371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTPQRGRTAVPLRLLPAAHGGGGGGGGGGGASSWLLDGNSWLLCYGLIYLALYAQVSQS
KPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCT
WLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEV
VTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVSSQAYCECDKYWK
GEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFS
PSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGAVSRGPLQRYGHSL
ALYQDNIFMYGGRIETSDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME
LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKS
IYVHGGYKALPGNKYGLVDDLYKYEVNPKTWTILKESGFARYLHSAVLINGAMLIFGGNT
HNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFS
SVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCIWNKNHCESWDSGNTNNILRAKCPLKT
AASDDRCYRYADCASCTANTNGCQWCDDKKCISSTSNCSMSVKNYTKCHVRNEQICNKLT
SCKSCSLNLNCQWDQRQQECQALPAHLCGEGWIHVGDACLRINSSRENYDNAKLYCYNLS
GNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE
PNDSGFCAYLERAAVAGLKANPCTSMADGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCT
SNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGW
CNDPSNTGRGHCIEGSSRGPMKLVGMLNNEMLLDTSLCPKEKNYEWSFIQCPACQCNGHS
TCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHMHTGKCFCTT
KGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQS
NKNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKTNIKEYRDSFSYEKFNFRSNP
NITFYVYVSNFSWPIKIQ
Download sequence
Identical sequences W5Q342
ENSOARP00000017130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]