SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017204 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017204
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.16e-108
Family PDEase 0.000000000015
Further Details:      
 
Domain Number 2 Region: 137-331
Classification Level Classification E-value
Superfamily GAF domain-like 2.12e-44
Family GAF domain 0.0000744
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017204   Gene: ENSOARG00000016017   Transcript: ENSOART00000017445
Sequence length 865
Comment pep:known_by_projection chromosome:Oar_v3.1:6:5958976:6103828:1 gene:ENSOARG00000016017 transcript:ENSOART00000017445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGPGSARPQQQWNQDSVEAWLDDHWDFTFSYFVRKGTREMVNAWFAERVHTIPVCKE
GIKGHTESCSCPLQPSPRAESSVPGTPTRKISASEFDRPLRPIVIKDSEGTVSFLSDSDK
KEQMPLTSPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYRTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENLGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEETTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLRITDFSFSDFELSDLETALCTIRMFTDLNLVQSFQMRHEVLCKWILSVKKNYRKSV
AYHNWRHAFNTAQCMFAALKAGKIQKRLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIK
RRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKTLINGESSQTKRN
Download sequence
Identical sequences W5Q3B6
XP_004009635.1.66739 ENSOARP00000017204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]