SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017217 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017217
Domain Number 1 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 175-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 297-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017217   Gene: ENSOARG00000016029   Transcript: ENSOART00000017458
Sequence length 527
Comment pep:known_by_projection chromosome:Oar_v3.1:14:15011185:15075877:-1 gene:ENSOARG00000016029 transcript:ENSOART00000017458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHLFNLSSLISLVLLVTVLVVEGIAVAQKTQDGQNIGMKHVPATQCGIWVRTSNGGHFAS
PNYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEIRDGPFGFSPLID
RYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQF
ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFV
AVYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTG
STFFCHSNMCINNSLVCNGIQNCAYPWDENHCKAEKKKAGLFEQITKTHGTIIGVTSGIV
LVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEMSADLADLSEE
LDSYQKTRRSSTASRCIHDHHCGSQAPSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTF
RKSSYTFKQAHECPEQALEDRVMEEMPCEIYVRGREDSAQASMSIDF
Download sequence
Identical sequences W5Q3C9
ENSOARP00000017217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]