SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017252 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017252
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 1.01e-38
Family SRP19 0.000000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017252   Gene: ENSOARG00000016066   Transcript: ENSOART00000017496
Sequence length 144
Comment pep:novel chromosome:Oar_v3.1:7:875802:883619:-1 gene:ENSOARG00000016066 transcript:ENSOART00000017496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCAAVGLNV
FLEKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGVGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences W5Q3G3
ENSOARP00000017252 XP_004010221.1.66739 XP_012012548.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]