SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017295 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017295
Domain Number 1 Region: 259-501
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.85e-81
Family Eukaryotic proteases 0.0000000782
Further Details:      
 
Domain Number 2 Region: 63-101
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000000148
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 3 Region: 191-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000183
Family EGF-type module 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017295   Gene: ENSOARG00000016105   Transcript: ENSOART00000017540
Sequence length 511
Comment pep:known_by_projection chromosome:Oar_v3.1:2:116948259:116959680:-1 gene:ENSOARG00000016105 transcript:ENSOART00000017540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGQACSFSVAHPSGCGFRMWQLSSLLLFVTVWGIFSTPAPPDSVFSSSQRAHQVLRI
RKRANSFLEELRPGSVERECSEEVCEFEEAREIFQNTEDTVRPPDWVQNMRLKGLKPGCS
GHLSCVSPTSSCWSLSSEHTHSGRPDRLRKEGGAGKRRSRHAAGGGPGPAGRVEPRRPRG
ALRVCPEVRFTNCSAENGGCAHYCLEEAGRRHCSCAPGYRLQDDHQLCEPKVTFPCGRLG
KRMEKKRKTLKRDTNQVDQEDQLDPRIVSGQEARWGDSPWQAVLLDSKKKLVCGAVLIHV
SWVLTVAHCLESHKKLIVRLGEYDMRRWESWEVDLDIKEVIVHPNYTKSTSDNDIALLRL
AKAATLSQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRDETKKNRTSILNFIKIPVVP
YNACVHAMENKVSENMLCAGILGNSRDACEGDSGGPMVTFFRGTWFLVGLVSWGEGCGRL
YNYGVYTKVSRYLDWIYGHIKAEAPLESQVP
Download sequence
Identical sequences W5Q3K6
ENSOARP00000017295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]