SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017454 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017454
Domain Number 1 Region: 180-375
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-59
Family Astacin 0.00007
Further Details:      
 
Domain Number 2 Region: 807-914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-38
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 382-491
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-36
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 4 Region: 491-600
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-35
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 647-757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 6 Region: 938-1031
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 758-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017454   Gene: ENSOARG00000016252   Transcript: ENSOART00000017701
Sequence length 1042
Comment pep:known_by_projection chromosome:Oar_v3.1:17:1296804:1628237:1 gene:ENSOARG00000016252 transcript:ENSOART00000017701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGGVFAGLAATGAVLCAELGVCAGL
DYEYTFGGYGEDEAETLDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGKFGH
TTGGFGDHGMSKKRGALYQLIDRIRRIGSGLEQNNTVKEKLPLKFSGQNEKNRVPRAATS
RTERVWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERGDEESYIVFTYRPCG
CCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPG
QEYNFLKMEPGEVNSLGESYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTR
LSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNF
TTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTESRMWIEFRSSSNWVG
KGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIAVSEDCYVGLIFQAFEIER
HDNCAYDYLEVRDGTNESSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANF
FKEEDECAKPDRGGCEQHCLNTLGSYQCACEPGYELGPDRRTCEAACGGLLTNLNGTITT
PGWPKEYPPNKHCIWQVVAPTQYRISMKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGK
YCGAEVPEVITSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTVGS
YLCQCRNGFVLHENKHDCKEAECEQKIHSPSGFITSPNWPDKYPSRKECTWEISATPGHR
VKLAFTEFEIEQHQECAYDHLEVYDGETDKSPVLGRLCGNKIPEPLVATGNNMFVRFVSD
ASVQRKGFQAAHSTECGGRLKVESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLEL
SFQIFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDTVLIHFHTDDTI
SKKGFHIRYKSIRYPDSPHTKK
Download sequence
Identical sequences W5Q415
ENSOARP00000017454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]