SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017551 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017551
Domain Number 1 Region: 494-679,887-1026
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-59
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3693-3883
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.67e-27
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2226-2269,2351-2394
Classification Level Classification E-value
Superfamily E set domains 0.00000000527
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4434-4509
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000255
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000017551
Domain Number - Region: 3661-3722,4001-4079
Classification Level Classification E-value
Superfamily ARM repeat 0.0037
Family Mo25 protein 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017551   Gene: ENSOARG00000016305   Transcript: ENSOART00000017799
Sequence length 4686
Comment pep:known_by_projection chromosome:Oar_v3.1:10:52632844:52906106:-1 gene:ENSOARG00000016305 transcript:ENSOART00000017799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEGSLAAAGLGLGLPAPDSRGHYQLLLSGRALADRYRRIYTAALSDRDQGGSSAGHPASR
NKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCVLEW
QKKETSLAAASKNSVQSGESDSDEEEESKEPPIKLPKIIEVGLCEVFELIKETRFSHPSL
CLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITVRSTGMNDSTGQSLTALSCAC
LFSLVASWGETGRTLQAISAILTNNGSHACQTIQVPMILNSLQRSVQAVLVGKIQIQDWF
SNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYN
STSRIRNRKEKKSWLGYAQGYLLYRDVNNHSMTAIRISPETLEQDGTVLLPDCHTEGQNI
LFTDGEYINQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLH
IISTGFDEESAVLGAGREFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITKSPK
IVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVV
YTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGE
VWTFGVNNKGQCGRDTGAMNQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGMHKW
KLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACARELDGQ
EARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLDEGRGPLVF
AGPIFMNHREQALARLRSHPAQLKHKRDKHKDGSGERGEKDASKITTYPPGSVRFDCELR
AVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSN
HTAALLMDGQVFTFGSFSKGQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASGDQT
FLRIDEALINSHVLATSEIFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQE
DLQGFGVCLDPVYDVIWRFRPSTRELWCYNAVVADARLPSAADLQSRCSILSPELALPTG
SRALTTRSHAALHILGCLDTLATMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHG
GGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDLLAE
TDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQ
FKSSKKSNNGTDVNAGQIPQLLYRLPTSDGGASKGKQQTSEPVHILKRSFARTVSVECFE
SLLSILHWSWTTLVLGVEELRGLKGFQFTATLLDLERLRFVGTCCLRLLRVYTCEIYPVS
ATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMVKLDNDPQGYLSQPLSLLEAVLQE
CHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRLLAAVMSALCHTSVK
LTSIFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQNEENISGMTSFREV
LEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSEVDGLNSLHSV
KASANRFTKTSQGRSWNTGNGSPDAICFSVDKPGIVVVGFSVYGGGGIHEYELEVLVDDS
EHAGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTA
NGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRSEFDGDLQSQLLSKANE
EDKNCSRALSVVSTVVRAAKDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGPVAA
AIPKVAVEVFGLVQQLLPSVAILNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSNHYA
VIESEHPYKPACVMHYKVTFPECVRWMTLEFDPQCGTAQSEDVLRLLIPIRTVQNSGYGP
KLTAVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCF
AIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPVGNELEEDLEILEEAALQVC
KTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFIACVPGSSGGRLARWLQP
DSYADPQKTSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQ
QEQVKKPQRIPGSPAVPPASSNTDMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYEN
YSFEELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAIGLYTIHVTIDGIEIDAGLEVK
VKDPPKGMIPPGTQLVKPKTEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTI
TFIDEIHNDDGVWLRLNDETIKKYVPNMNGYTEAWCLSFNQHLGKSLLVPVDEPKTNTDD
FFKDINSCCPQEATMQEQDMPFLRGGPGMYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGN
KVKAVGEVTNSEGTWVQLDKNSMVEFCESDEGEAWSLARDRGGNQYLRHEDEQVLLDQNS
QTPPPSPFSVQAFNKGASCSAQGFDYGLGNNKGDQLSAILNSIQSRPNLPAPSIFDQAAK
PPSSLVHSPFVFGQPLSFQQPQLQSDRGTISASPRPVCTSGKPELSSKHSRALKPDGRMS
RTAAEQRKPRGTEGLSASESLMLKSDAAKLRSDSHSRSLSPNHNTLQTLKSDGRMSSGFR
AESPGPGSRSSSPKPKTLPANRSSPSGASSPRSSSPHDKNLPQKSTAPVKTKLDPPRERS
KSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKPKPVPKDSKDSPGSENRAPSPHVVQENLH
SEVVEVCTSSTLKTNSLTDSTCDESSEFKSVDEGSNKVHFSIGKAPLKEEQEMRASPKIS
RKCANRHTRPKKEKSSFLFKGEGSKPLEPAKQAMSPSVAECARAVFASFLWHEGIVHDAM
ACSSFLKFNPDLSKEHAPIRSSLNSQQPSEEKETKLKNRHSLEISSALNMFNIAPHGPDI
SKMGSINKNKVLSMLKEPPLHEKCEDGKAEATFEMSTHHTTKSKSPLPLTLQHLVAFWED
ISLATIKAASQNMIFPSPGSCAVLKKKECEKENKKAKKEKKKKEKTEVRPRGNLFGEMAQ
LAVGGPEKDTICELCGEPHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDG
GIGGSTWYLVCDRCREKYLREKQAAAREKVKQSRRKPMQVKTPRALPTMEAHQVIKANAL
FLLSLSSAAEPSILCYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGY
QDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSLETSPITDTDLAK
RTVFQRSYSVVASEYDKQHSILPARVKAIPRRRVNSGDTEVGSSLLRHPSPELSRLISAH
SSLSKGERNFQWPVLAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTS
LHDVLWHFVASLTPAPVEPEEEEDEENKTNKENAEQEKDTRVCEHPLSDIVIAGEAAHPL
PHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKQSDHQFLHQSNVFHHINNILSKS
DDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFW
ESGDEDKNKTKNITINCVKGINARYVSIHVDNSRDLGNKVTSMTFLTGKAVEDLCRIKQV
DLDSRHIGWVTSELPGGDNHIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQISASVA
QQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHM
VGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPNDEDASSDAY
CFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPN
RLASIIGVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTA
GTSVGKGVTTVTLPMIFNSSYIRRGESHWWMKGSTPTQISEIIIKLVKDMAAGHLSEAWS
RVTKNAIAETIIALTKMEEEFRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKD
GQQKQMPMCDNHDDGETAAIILCNVCGNLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIKV
DLHEGCGRTKLFWLMALADSKTMKAMVEFREHTGKPTTSSSEACRFCGSRSGTELSAVGS
VCSDADCQEYAKIACSKTHPCGHPCGGVKNEEHCLPCLHGCDKSAATLKQDADDMCMICF
TEALSAAPAIQLDCSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLD
PIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYF
GGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFG
TTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVC
RNAHTF
Download sequence
Identical sequences W5Q4B1
ENSOARP00000017551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]