SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017762 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017762
Domain Number 1 Region: 537-566,665-742
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017762   Gene: ENSOARG00000016539   Transcript: ENSOART00000018013
Sequence length 761
Comment pep:known_by_projection chromosome:Oar_v3.1:19:51196175:51206547:1 gene:ENSOARG00000016539 transcript:ENSOART00000018013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSEAPGERDTQALLSRTQAMELRRRDYRVERPLLNQEQLEELGSRSPAPVTLQWRTWF
RCSRARAQALLLQYLPVLAWLPQYSVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
YGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGSVMESLAPDDAFLLGLNSTVNVTAR
DDTRVQLASTLSVLVGLFQVGLGMVHFGFVVTYLSEPLVRAYTTAASVHVFISQLKYVFG
LHLSSRSGPLSLIYTVLEVCWKLPQTVVGTVITAIVAGVVLVKLLNEKLRRHLPMPLPGE
LLTLIGATGISYGVGLQQAFGVDIVGKIPAGLVPPKAPHPQLFAKLLGNAFAIAVVGFAI
AISLGKIFALRHGYRVYSNQAWTPRTTSDVCSLLTPRSAVSCSMSRSLVQESTGGNTQVA
GAVSSFFILIIIVKLGELFQDLPKAVLAAVVIVNLKGMVMQFTDVFSLWKANRMDLLIWV
VTFVATILLNLDLGLAVAVVFSLMLVVVRTQMPHYSVLGQMPDTDIYRDLAEYSGAREVP
GVKVFRSSATVYFANAELYSDSLKQRCGVDVDYLLSQKKKLLRKQELKLKRLQKENKLPK
QAAASKGTSISINVNTTVVDIESNNDVEGSKAKEASAGTELEETGAWAPEDAKASDMSSL
KALGLPQPDFHTLILDLSSFSFVDTVCLKSLKNIFRDFREIEVEVYMAACHAPVIKQLED
GHFFDASITKQHLFASVHDAVLFALQQRRSSPVDPVLVTKL
Download sequence
Identical sequences W5Q4X2
ENSOARP00000017762 XP_011955481.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]