SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017807 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017807
Domain Number 1 Region: 324-448
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-36
Family Netrin-like domain (NTR/C345C module) 0.00000182
Further Details:      
 
Domain Number 2 Region: 160-273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-36
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 38-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-35
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017807   Gene: ENSOARG00000016574   Transcript: ENSOART00000018058
Sequence length 451
Comment pep:known_by_projection chromosome:Oar_v3.1:24:35843017:35847949:-1 gene:ENSOARG00000016574 transcript:ENSOART00000018058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASFLGPLLTAWALLLPFTHGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPP
NKECIWTITVPKSQTVSLSFRVFDLEQHPSCRYDALEIFAGSGTSGQQLGRFCGTFRPAP
LVASGNQVTLRMRSDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESD
YPPGISCSWHIIAPPDQVISLTFGKFDLEPDSYCRYDSVSVFNGPVSDDAKRLGKFCGDT
VPGSITSEGNELLVQFVSDLSVTADGFSASYRIQPRGATEEGPGEVGPGPKPGAGPKVKP
EVPPEEKPKAAPKAEATPVGPDAPSVTCPKQCRRTGTLQSHFCNSDLVVTGMIKSMVRGP
GEGLTATVNVTGVYKTGGLDLPSPPTDSLLKFYVPCKQCPPMKKGISYLLMGQMDKNRGP
ILPPESFVVLHRPTQHQILTNLSRKCPSKPV
Download sequence
Identical sequences W5Q517
XP_004021061.1.66739 XP_011997092.1.54773 ENSOARP00000017807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]