SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017872 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017872
Domain Number 1 Region: 301-505
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.83e-24
Family Regulator of chromosome condensation RCC1 0.0039
Further Details:      
 
Domain Number 2 Region: 66-157
Classification Level Classification E-value
Superfamily F-box domain 3.4e-16
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017872   Gene: ENSOARG00000016636   Transcript: ENSOART00000018123
Sequence length 621
Comment pep:known_by_projection chromosome:Oar_v3.1:24:35849164:35858117:-1 gene:ENSOARG00000016636 transcript:ENSOART00000018123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWERQQGRGPGSQGARRDEGRSREGAVRMVRRSRSRKLQKLTGLCRREEGLRVKRSCPS
CGPSEPGGEEKKGRGNPVSVQLFPPELVEHITSFLPVRDVVALGQTCHYFHQVCDAEGVW
RRICHQLSPRLREQGSGVRPWKRAAILNYTKGLYFQAFGGRRRCLSKSVAPQLAHGYRRF
LPTKDHVFILDYAGTLFFLKNALVSSTLGQIQWKRACRYVVLCRGAKDFASDPRCDTVYR
KYLYVLATREQPGVVGTTSSRACDCVEVYLQSSGQRVFKMTFHHSMSFKQIVLVGQETQR
ALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSRCLPHLRVACMASNQSSTLYITD
QGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKILFCALGYNHLGLVDEFGRI
FMQGNNRYGQLGTGDKMDRGEPTQVHYLQRPIALWCGLNHSLVLSQGSDFSKELLGCGCG
AGGRLPGWPKGSASFVKLHIKVPLCACSLCSTRECLYMLSSHDIEHHPAYRDLPASKAVG
TPEPSLGAGATQDPGGVAWACEEYLSQIHSCPTLQDRMEKMKEIVGWMPLMAAQKDFFWE
ALDMLQRAAGGAGQGPPPAES
Download sequence
Identical sequences W5Q582
ENSOARP00000017872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]