SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017913 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017913
Domain Number 1 Region: 428-666
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-54
Family WD40-repeat 0.0000544
Further Details:      
 
Domain Number 2 Region: 274-329,356-407
Classification Level Classification E-value
Superfamily F-box domain 0.000000000785
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017913   Gene: ENSOARG00000016680   Transcript: ENSOART00000018164
Sequence length 1023
Comment pep:novel chromosome:Oar_v3.1:11:32555397:32585770:-1 gene:ENSOARG00000016680 transcript:ENSOART00000018164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLESRLKNAPYFRCEKGNDSLPVCQKCETCILAWKIFSTREWFWRVGAGFQRRFLVSV
LQQLDSPYLLHYFLTLLQTTQGKDLVYHRTRVDLSRKEGKMIQSWNQTLDETVEQKMREA
LRWLQNSSQRTKANYTLLLLQMCDPGLLLTATDVIRVLFLREWGDASGTDPDFTNMFLIP
EKGRVHSCDTSQVCWAARTRHTTFPLSKAAGKRIQSDPIERLSTQMQWKSSLQCISEMNR
LFSEKAKSGLAPAPDVLLELDTVRKLSSGVSRYCDFIRQLPIHLSKYILSLLDRSTLNRC
SFVSQHWAALAQQVKTDLSMHSFIQHQITFLQVWPVWEGQFPQGSYTRGIDPSYASKVII
PIPKMTDDGKRLRVKNQKWKLRTKNDYNLWTAYQNQETQQVQMEERNVFCGSYNIRILSD
TWDRNRIIHYSGGDLLAVSSNRKIQLLDIIRVKEIPIRFRGHAGSVRALFLCEEENFLLS
GSYDLSIRYWDLKSGACIRIFNGHQGTITCMDVYKNKLASGAKDCQVKEWDIETGKCLKT
FKHKDPILDTRINDTYIVSSCEKGLVKVWHMATAQLVKTLNGHEGAVKCLYFDQWHLLSG
STDGLVMAWSMVGKYERCLMAFKHPKEVLHVALLFLRVISACADGKIRIYNFLNGNCLKV
MKANGRGDPVLSFFIQGNRMVINTESNILLFQFENIKWQYSVERAKQKKKDREEDREENS
FAEVLSKSSTQVYSPRDSVSSRQTAQESLLSKPHRSRIFRRTSRLPTGETAEPRQKSWGI
PMSPDQFLLTVNALQKVHNSGEFAYPRRPQAQIIDVWGPSIPYPRKVLSLKGQVVQQAVD
RLRFSTPPIEVKQTNIPLKIQKLQPNLKKSVHGPRVQSTIPQPVLICPRFRGGSKGEDRA
TSSTDGVRNFSPLTSPQVIKPNRMLAPLVSTAAQAARKERPRFCSALDPLRVNTEFMLLT
VKEQKEYREARMKEFQAIKPVGAVDPEKASRAAWIRKIKGLPIDNFMKLGKTAAPELGQN
VFI
Download sequence
Identical sequences W5Q5C3
ENSOARP00000017913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]