SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018006 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018006
Domain Number 1 Region: 34-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.54e-40
Family Frizzled cysteine-rich domain 0.000000209
Further Details:      
 
Domain Number 2 Region: 178-289
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018006   Gene: ENSOARG00000016764   Transcript: ENSOART00000018258
Sequence length 325
Comment pep:known_by_projection chromosome:Oar_v3.1:2:125758277:125790085:1 gene:ENSOARG00000016764 transcript:ENSOART00000018258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGSRGGMLLLPAALLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPESLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGVSSERCKC
KPVRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAAVEVKEILKASLVNIPRETVNLYTS
SGCLCPPLNVNEEYLIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLNT
SDSSHSDSTQSQKPGRNSNSRQVRN
Download sequence
Identical sequences W5Q5L6
ENSOARP00000018006 XP_011987239.1.66739 XP_011987248.1.66739 XP_012011302.1.54773 XP_012011303.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]