SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018044 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018044
Domain Number 1 Region: 173-420
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.97e-35
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000068
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018044   Gene: ENSOARG00000016804   Transcript: ENSOART00000018296
Sequence length 432
Comment pep:known_by_projection chromosome:Oar_v3.1:22:21525775:21612148:-1 gene:ENSOARG00000016804 transcript:ENSOART00000018296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPRGRSWVARAAWGPPGTVGPASGAGNVAAGPSGEPACRPAAGPALLCLPEELLLLIFS
YLDMQALGRLAQVCRWLRRFTSCDLLWRRIARASPPPPRPRAGPRPGMASVPVKERVKVS
QNWRLGRCREGILLKWRCSQMPWMQLEGDSLYISQANFILAYQFRPDGASLNRRPLGVFA
GHDEDVCHFVLANSHIISAGGDGKIGIHKIHSTFTVKYSAHVQEVNCVDCKGGIIVSGSR
DRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSG
QLMTHLGSDFPPGAGVLDVMYESPSTLLSCGYDTYVRYWDLRASARKCVMEWEEPHDSTL
YCLQTDGNHLLATGSSYYGVVRLWDRRQRACLHAFPLTSTPLSSPVYCLRFTTRHLYAAL
SYNLRVLDFQNP
Download sequence
Identical sequences W5Q5Q4
ENSOARP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]