SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018162 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018162
Domain Number 1 Region: 826-910
Classification Level Classification E-value
Superfamily DEATH domain 5.53e-24
Family DEATH domain, DD 0.0000516
Further Details:      
 
Domain Number 2 Region: 131-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 279-326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000017
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018162   Gene: ENSOARG00000016907   Transcript: ENSOART00000018419
Sequence length 915
Comment pep:known_by_projection chromosome:Oar_v3.1:6:29146028:29348864:1 gene:ENSOARG00000016907 transcript:ENSOART00000018419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWQYEDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNS
EWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRK
AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFY
ITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCG
RGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPAVDGRWTSWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFIYPISTEQRTQNEYGFSSAPDSDDV
ALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDSDL
LAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLS
EFASKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGTFNSLGGHLVIPNAGVSLLIP
AGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTMHHCADP
STEDWKIQLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHLLSENLGTYALVGQSTT
KAAAKRLKLAIFGPLCCSSLEYSLRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFK
GSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERFSLNTVELVC
KLCVRQVEGEGQIFQLNCTVSEEPTGMDLPLLDPASTITTMTGPSAFSIPPPIRQKLCSS
LDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
MGRHETVVSLAEGQY
Download sequence
Identical sequences W5Q622
ENSOARP00000018162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]