SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018163 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018163
Domain Number 1 Region: 804-888
Classification Level Classification E-value
Superfamily DEATH domain 5.36e-24
Family DEATH domain, DD 0.0000516
Further Details:      
 
Domain Number 2 Region: 131-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 276-330
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000163
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018163   Gene: ENSOARG00000016907   Transcript: ENSOART00000018420
Sequence length 893
Comment pep:known_by_projection chromosome:Oar_v3.1:6:29146028:29348864:1 gene:ENSOARG00000016907 transcript:ENSOART00000018420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWQYEDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNS
EWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRK
AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFY
ITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCG
RGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRR
RECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVV
ALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALH
DVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFASKLSPQMTQSLLENEALNL
KNQSLARQTDPSCTAFGTFNSLGGHLVIPNAGVSLLIPAGAIPQGRVYEMYVTVHRKENM
RPPMEDSQTLLTPVVSCGPPGALLTRPVILTMHHCADPSTEDWKIQLKNQAAQGQWEDVV
VVGEENFTTPCYIQLDAEACHLLSENLGTYALVGQSTTKAAAKRLKLAIFGPLCCSSLEY
SLRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKL
LAKYQEIPFYHIWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSE
EPTGMDLPLLDPASTITTMTGPSAFSIPPPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDR
YLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAEGQY
Download sequence
Identical sequences W5Q623
ENSOARP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]