SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018206 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018206
Domain Number 1 Region: 501-831
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.04e-113
Family PDEase 0.000000269
Further Details:      
 
Domain Number 2 Region: 52-248
Classification Level Classification E-value
Superfamily GAF domain-like 8.51e-22
Family GAF domain 0.0015
Further Details:      
 
Domain Number 3 Region: 235-287,322-370
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000632
Family GAF domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000018206
Domain Number - Region: 423-460
Classification Level Classification E-value
Superfamily GAF domain-like 0.0647
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018206   Gene: ENSOARG00000016949   Transcript: ENSOART00000018464
Sequence length 858
Comment pep:known_by_projection chromosome:Oar_v3.1:6:116901725:116929069:-1 gene:ENSOARG00000016949 transcript:ENSOART00000018464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEGQVHRFLDQNPGFADQYFGRKLSPEDVASACEDGCPEGCTSFRELCQVEESAALF
ELVQDMQESVNMERVVFKILRRLCSILRADRCSLFMYRQRNGVAELATRLFSVQRAEPAQ
SLPASSETAPPARVGKLGGSEVGPGCKGQLDQDKAQCPHFCSFADELTDYVTRNILATPV
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFLKYLNFGTLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMAKEKEFFDVWPVLRLWAVSD
GPRVCTVHEILFYKVIDYILHGKEDIKVIPSPPADHWALASGLPTYVAESGFICNIMNAP
ADEMFNFQSSAGAGGASKSRGRRDHSARTVRRPGGRLPGGAAPRGRDPGPGAGRGGAVGD
VRLQSLTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDREEIQLILEGREALRR
AGADCEEDELGKILKEVLPGPGKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQI
PQEVLVRFLFSVSKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGL
CHDIDHRGTNNLYQLKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEH
VIHLMDIAIIATDLALYFKKRTMFQKIVDESKNYEDRKSWVEYLSLETTRKEIVMAMMMT
ACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFI
DFVCTFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKLKALEEGQKEATAAKKAG
TEICNGGPAPRSSTCCIL
Download sequence
Identical sequences W5Q666
ENSOARP00000018206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]