SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018214 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018214
Domain Number 1 Region: 69-184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000706
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018214   Gene: ENSOARG00000016960   Transcript: ENSOART00000018473
Sequence length 330
Comment pep:known_by_projection chromosome:Oar_v3.1:7:7910104:7922061:1 gene:ENSOARG00000016960 transcript:ENSOART00000018473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTLKLQCHFILVCLLALRGESRYLEPAARIPIAKGRRVGRGGAPGRDGVTLREPGAEA
GRRGSGCVDMLSLQGQFTFTADRPQLHCATFFIAEPEEFITIHYDLVSIDCLRGDILGKV
FDGWILKGEKFPSSQDHPLPTTERYVDFCDSGLSRRSIRSSQNVAMIFFRVHEPGNGFTI
TVKTEPNLFPCNIISQTPNGRFTLVMPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKK
SSAGCGGIGDFVELLGGTGLDPSKMLLLADLCYPLRGPAQMKVGCDHTVLRMVSSGKHIN
RVTFEYRQLEPYELENPNGNSIQEFCLSTL
Download sequence
Identical sequences W5Q674
ENSOARP00000018214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]