SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018431 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018431
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 9.2e-75
Family Thiolase-related 0.0025
Further Details:      
 
Domain Number 2 Region: 2154-2362
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.52e-46
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000109
Further Details:      
 
Domain Number 3 Region: 492-616,680-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.1e-38
Family FabD-like 0.0038
Further Details:      
 
Domain Number 4 Region: 1644-1782
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.56e-36
Family Alcohol dehydrogenase-like, C-terminal domain 0.00016
Further Details:      
 
Domain Number 5 Region: 1671-1714,1850-2035
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.67e-21
Family Tyrosine-dependent oxidoreductases 0.0076
Further Details:      
 
Domain Number 6 Region: 1562-1673
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000262
Family Alcohol dehydrogenase-like, N-terminal domain 0.0067
Further Details:      
 
Domain Number 7 Region: 1244-1407
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000285
Family UbiE/COQ5-like 0.053
Further Details:      
 
Domain Number 8 Region: 2054-2117
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000288
Family Acyl-carrier protein (ACP) 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000018431
Domain Number - Region: 616-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00017
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.011
Further Details:      
 
Domain Number - Region: 841-852,895-902
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0112
Family Formin homology 2 domain (FH2 domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018431   Gene: ENSOARG00000017168   Transcript: ENSOART00000018693
Sequence length 2372
Comment pep:known_by_projection chromosome:Oar_v3.1:11:49940273:49955854:1 gene:ENSOARG00000017168 transcript:ENSOART00000018693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLEEFWANLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHNMDPQLRLLLEVTYEAIVDAGINPASIRGTNTGVWVGVSGSEAAEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSITLDTACSSSLLALQRAYQAIQRGEC
AMAIVGGINILLKPNTSLQFMRLGMLSSEGTCKSFDASGDGYCRAEAVMAVFLTKKSLAR
RVYATILNAGTNTDGCKKQGVTYPSGEAQEQLISSLYKPAGLDPETLEYIEAHGTGTKVG
DPEELNGIVQALCGSRQGPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
NPNPKIPALQDGRLQVVDRPLPVLGGIVGINSFGFGGSNVHVILQPNSQPPPPPGPHAAL
PRLLLASGRTLEGVQGLLELGLQHSQNLAFVSMLNDIAAPSPAAMPFHGYAVLGSQEGSQ
EVQQVPTSKRPLWFICSGMGTQWRGMGLSLMRLSSFRDSILRSDEAVKPLGLRVSQLLLS
TDNIFDDIVVSFVSLTAFQIALIDLLTSMGLRPDGIIGHSLGEVACAYADGCISQEEAIL
SAYWRGQCIKEANIPPGAMAAVGRNSWWGCCRRSLPGIVPACHNSIDTVTISGPQASMLE
FVKQLKQEGVFAKEVQTGGMAFHSYFMDAIAPTLLQQLKKVIREPRLRSPRWLSTSIPES
QWQESLARTFSAEYNVNNLVSPVLFQEALWHVPENAVVLEIAPHALLQAILKRGLQPSCT
IIPLMKKDHRDNLEFFLSNVGQLYLTGCGRSPCSTWEAPQQPGHRAALRWSPGSGPLGAG
PPPPPPAPPPPPPGSSSPSATVYKIDISPESPDHYLVDHCIDGRVLFPATGYLCLVWKTL
ARALDQDMEHTPVVFEDVTLHQATLLPKTGTVLLEVRLLEASCTFEVSEKGSLIVSGKVY
QWEDPDPKLFDNRYGAEPATPVDPTTAIHLRCGDVYKELQLQGFNYGPNFQGILEASSEG
NMGQLLWKDNWVTFMDTMLQMSILAPGQRSLRLPTRITAIYIHPATHQQKLYTLQDGTQV
ADVVMNRCLDTTVAGGVYISRIHTSVAPRHQQEQPVPILEKFCFTPHVESGCLAGNLALQ
EELQLCVGLAQALQTKVAQQGIKMVVPGLDGTQAPQEAPQQGLPQLLATACQLQLNGNLQ
MGMGQILAQERALLCDDPLLSGLLNSPALKACVDTALENMTSLKMKVVEVLAGDGQLYSR
IPALLNTQPLLELDYIATDRHPQALEAAQAKLQQLNITQGQWDPSDPAPSNLGGANLVVC
NYALASLGDPATAVGNMVAALKEGGFLLLHTLLRGHPLGETVTFLTCPEPQQGQRHLLSQ
DEWESLFAGTSLHLVALKKSFYGSVLFLCRRLAPRDSPIFLPVEDTSFQWVDSLKNILAD
SSSQPVWLMAVGCTTSGVVGLVNCLRKEPDGHRIRCVLVSNLNSTSPIPEIAPKSLELQK
VLQSDLVMNVYRDGAWGAFRHFPLEQDKPEEQTEHAFINVLTRGDLSSIRWVCSPLRHSQ
STGPGVQLCTIYYASLNFRDIMLATGKLSPDAIPGNWASRNCMLGMEFSGRDASGKRVMG
LVPAEGLATSTLVPQSFLWDVPSNWTLEEAASVPVVYSTAYYALIVRGRMQPGETVLIHS
GSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQSRFPQLNETSFANSRDTSFEQHVLWH
TAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGEMGQQAWWAAGWAG
LTSRSGIRTGEWPEGGAVGRAFFRPLYGALKAPRLGTRPSLPIPSHCLCPTGYQARQVRE
WRRQGVQVLVSTRDVSSLDGTQRLITEAAQLGPVGGVFNLAVVLRDAMLDNQTPEFFQDV
NKPKYNGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQTNYGFANSTMERICEKRQHD
GLPGLAVQWGAIADVGILVELKGTNDKAIGGTLPQRITSCLEVLDLFLNQPHPVLSSFVL
AEKAASRGPSGSQQDLVKAVAHILGIRDLATINPDSSLSDLGLDSLMGVEVRQTLERERN
LTLSMREIRQLTIRKLQEISAQAGTADELTNSTHKLSSPAQSQTQLNLSTLLVNPEGPTL
TRLNSVQSSERPLFLVHPIEGSTTVFHSLAAKLSIPTYGLQCTRAAPLDSIQSLAAYYIE
CIRQVQPEGPYRIAGYSYGACVAFEMCSQLQAQQSAGPTNNSLFLFDGSCAPPRRDGGPG
VRSPSPCPCHCSTSSSRATYHGNVTLLRAKMGGAYGEGLGADYNLSQVCDGKVSVHIIEG
DHRTLLEGSGLESILSIIHSSLAEPRVSVREG
Download sequence
Identical sequences W5Q6U0
ENSOARP00000018431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]