SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018434 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000018434
Domain Number - Region: 70-94,169-176
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0183
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018434   Gene: ENSOARG00000017180   Transcript: ENSOART00000018696
Sequence length 242
Comment pep:known_by_projection chromosome:Oar_v3.1:22:36013922:36020775:-1 gene:ENSOARG00000017180 transcript:ENSOART00000018696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSKTFMRQMPITPGYSGFVPYLSCQGTSSEDNMAHCLKIFQENTQRYKDQLEEFHCSV
AAAPKLKPVRSEGTVLRTLHQYYRQYHPLSLECKNIKKPLHEPPIPGWGGYLPGWAGSLQ
RARVTELGCSTRYTVMARNCYRDFLDLVERAKQAHLKPYEEIYGVKSTPPPPTPPPKVLL
HEGLLPKYPDFSVPGVRCPTLSRALMEDPRPQMMCGCTQRPSVWCSRKIYLEPLSARKDM
EV
Download sequence
Identical sequences W5Q6U3
ENSOARP00000018434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]