SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018664 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018664
Domain Number 1 Region: 588-892
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.87e-115
Family PDEase 0.0000000742
Further Details:      
 
Domain Number 2 Region: 177-376
Classification Level Classification E-value
Superfamily GAF domain-like 1.11e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 360-557
Classification Level Classification E-value
Superfamily GAF domain-like 8.94e-41
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018664   Gene: ENSOARG00000017378   Transcript: ENSOART00000018927
Sequence length 914
Comment pep:known_by_projection chromosome:Oar_v3.1:2:130949077:131370341:1 gene:ENSOARG00000017378 transcript:ENSOART00000018927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASRLDFGEVETFLDRHPELLEDYLMRKGKQEMVEKWMQRHGQGQGAVGPRPTPAASVS
GGQPTPGGGECRGAPMGPSWASGNRGDESLQRRASQKELRKSFARSKAIHVNRTYDEQVT
ARAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRVNLPQYPPTAMDYKCHLKKHNER
QFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSLFLVEGAAAGKKSLVSKFFDVHA
GTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIPDAYQDRRFNDEIDKLTGYKTKS
LLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQMYLPFCGIAISNAQLFAASRKE
YERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSF
ELMSPKCSADAENSFKESMEKSSYSDWLINNSVAELVASTGLPVNISDAYQDPRFDAEAD
QISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTI
MYDQVKKSWAKQSVALDNQVLSYHATCSKAEVDKFKAANIPLVSELAIDDIHFDDFSLDV
DAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQLMFAML
TTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTSATLEHHHFNH
AVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFELVSKGEYNWNI
KNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERAELKLTPSAIFDRN
RKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHRKRLLVSTAAS
APSANVMETRDDRN
Download sequence
Identical sequences W5Q7H2
ENSOARP00000018664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]