SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018729 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018729
Domain Number 1 Region: 1378-1441,1475-1655
Classification Level Classification E-value
Superfamily VPS9 domain 4.45e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.02e-38
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 3 Region: 519-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.14e-27
Family beta-lactamase inhibitor protein-II, BLIP-II 0.077
Further Details:      
 
Domain Number 4 Region: 1047-1136
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.16e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0099
Further Details:      
 
Domain Number 5 Region: 1141-1249
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.92e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.026
Further Details:      
 
Domain Number 6 Region: 927-1014
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000007
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 692-893
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000119
Family DBL homology domain (DH-domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018729   Gene: ENSOARG00000017445   Transcript: ENSOART00000018995
Sequence length 1657
Comment pep:known_by_projection chromosome:Oar_v3.1:2:202925914:202974248:-1 gene:ENSOARG00000017445 transcript:ENSOART00000018995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKKSSTEAEGSKERGLVHVWQAGSCSVTPERLPGWGGKTVLHAALGVKHGVLLTEDG
EVYSFGTLPWRNEPAETCPSNPILESALVGQYVVTVATGSFHTGAVTDSGVVYMWGENSS
GQCAVANQPYVPEPNPVSISDSETSPLLAVRILQLACGEEHTLALSLSREIWAWGTGCQL
GLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAEIQASTTLSPSSETLDSQGEVFENTLVQNEPP
AATELNVGNVQTASVQTTSSPQDIMGTTEVSSARSIPSYPDTQAVNEYVQKLSDHSVREN
SENGEKPVPSQPLVEEAIPHLHSPPTTSASALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYNAAPCESGALAGSSSIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTV
PRLAKVNSENGVWSVAAGQDYSLFLVDTEDFQPGLCYSGRQDPTEGDNLPENHSGTKMPV
LLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPL
LGLENLGTANTVQLLQEVASRFSKLCYLIGQHGTSLSSFLQGIKEARSLVILKHASLFLD
SYTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVDDENTQLMEILNTLFFLP
IRRLHSYAKVLLKLATCFEVASPEYQKLQDSSSCYESLALHLGRKRKEAEYTLSFWKTFP
GKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLW
AEPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGLSDLPPYGSG
SSIQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGL
EDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRS
GKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGLWQDDVCQGNGVVVTQFGLYYEG
NFHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKIT
GTYFKPSLYESDKDRPKAFRKLGNLAVPADEKWKAVFDECWHQLGCENPGQGEVWKAWDN
IAVALTTNRRQHRDSPEILSRSQTQTLESLEFIPQHVGAFSVEKYDDIKKYLIKACDTPL
HPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTI
PLSAPLPTERKSFCTGKSDSRSESPEPGYVVTGSGLLLPVLLPRLYPPLFMLYALDNDRE
EDVYWECVLRLNKQADLALLGFLGVQRKFWPVTLSVLGESKKVLPTTKDACFASAVECLQ
QISTTFTPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSE
VHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences W5Q7N7
XP_004004879.1.66739 XP_011998031.1.66739 XP_011998041.1.66739 XP_011998049.1.66739 XP_011998058.1.66739 XP_011998069.1.66739 XP_014948973.1.66739 ENSOARP00000018729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]