SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018783 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018783
Domain Number 1 Region: 31-142
Classification Level Classification E-value
Superfamily E set domains 1.02e-18
Family SVA-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018783   Gene: ENSOARG00000017501   Transcript: ENSOART00000019049
Sequence length 145
Comment pep:novel chromosome:Oar_v3.1:4:105972717:105976545:1 gene:ENSOARG00000017501 transcript:ENSOART00000019049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALQLLFKTSPAALLLGLFLTLWTLPTQGQTQNVISITLRVERVGNSDDYIVTLTVTSH
APVYLVVKATLEGSDDVNFPYGNFVYTACLCPNCSKNFFWDIQGPANGILIGKAEVVSEE
NICPSDVEISTPVYKVCSKREIVVT
Download sequence
Identical sequences W5Q7U1
ENSOARP00000018783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]