SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019093 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019093
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.84e-17
Family Regulator of chromosome condensation RCC1 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019093   Gene: ENSOARG00000017796   Transcript: ENSOART00000019361
Sequence length 74
Comment pep:novel chromosome:Oar_v3.1:9:94420218:94421539:-1 gene:ENSOARG00000017796 transcript:ENSOART00000019361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRYKPVLVGALKTLSVVFISCGYEHTAVLTQQDGKVFTFGDNSYGQLGHDSTAEKRGPQL
VERIEGLVSQIDCG
Download sequence
Identical sequences W5Q8Q1
ENSOARP00000019093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]