SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019126 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019126
Domain Number 1 Region: 295-454
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000337
Further Details:      
 
Domain Number 2 Region: 82-191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 195-292
Classification Level Classification E-value
Superfamily LCCL domain 1.7e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019126   Gene: ENSOARG00000017823   Transcript: ENSOART00000019394
Sequence length 779
Comment pep:known_by_projection chromosome:Oar_v3.1:1:161576324:161659181:-1 gene:ENSOARG00000017823 transcript:ENSOART00000019394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAVVRAGHSPQRFLVRAAVAAPARAALSLSRSYPLPFRSNSSSTSFPRPLFLLLLLI
LLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPHTYPNSTVCEWEIRVKTGERVRIKFG
DFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKSNEITVLFMSGIHVS
GRGFLASYSVIEKQDLITCLDTASSFLEPEFSKYCPAGCLLPFAEISGAIPHGYRDSSPL
CMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTL
GMESGVIADAQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQVDLN
KEKKITGIVTTGSTMVEHNYYVSAYKILYSADGQRWTVYREPGVDQDKIFQGNKDYHQDV
RNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRSSNDLRNTT
TPPKIAKGRAPKFTQPLQPRSSNEFPTQTEQTTATPEIKNTTVTPNVTKDVALAAVLVPV
LVMVLTTLILILVCAWHWRNRKKKTKGTYDLPYWDRAGWWKGMKQFLPAKSVEHEETPVR
YSSSEVNHLSPREVTTMLQTDSAEYAQPLVGGIVGPLHQRSTFKPEEGKEAGYADLDPYS
SPVQEVYHAYAEPLPVTGPEYATPIVMDMSGHPSAAAGLPSTSTFKAAGNQPPTSVGTYN
TLLSRTDSCSSAQAQYDTPKGGKPGPSAPDELVYQVPQSTQEVSEAGKEGECDVFKEVL
Download sequence
Identical sequences W5Q8T4
XP_004002919.1.66739 XP_012003719.1.54773 ENSOARP00000019126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]