SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019242 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019242
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.49e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 3.92e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000019242
Domain Number - Region: 418-450
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019242   Gene: ENSOARG00000017929   Transcript: ENSOART00000019510
Sequence length 469
Comment pep:known_by_projection chromosome:Oar_v3.1:15:62572511:62605563:-1 gene:ENSOARG00000017929 transcript:ENSOART00000019510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMDTESAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNSVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEDDDDDSADMDESDDDEEERQRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences W5Q950
XP_004016440.1.66739 XP_004016441.1.66739 XP_005982247.1.78601 XP_011989620.1.54773 XP_017914749.1.57651 ENSOARP00000019242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]