SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019705 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019705
Domain Number 1 Region: 169-347
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.77e-33
Family APC10-like 0.0024
Further Details:      
 
Domain Number 2 Region: 1788-1848
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000177
Family ZZ domain 0.0065
Further Details:      
 
Domain Number 3 Region: 1746-1797
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 57-124
Classification Level Classification E-value
Superfamily EF-hand 0.0000119
Family Polcalcin 0.053
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000019705
Domain Number - Region: 1073-1159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00236
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 2682-2771
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0301
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019705   Gene: ENSOARG00000018345   Transcript: ENSOART00000019978
Sequence length 2937
Comment pep:known_by_projection chromosome:Oar_v3.1:11:24228008:24318775:-1 gene:ENSOARG00000018345 transcript:ENSOART00000019978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPPPPGPARGPAAALLEPARLREAAAALRPTPPCESLVSRHHGALLRGLEERLGRGEES
VTLEQFRELLMARVARCNGENFHVAFAQFDAEGDGTVDAENMLEALKNSSGANLQGELSH
IIRQLQACSLIPGFIDIFSESKEGLDVHAAMILRFLHRNRLSSTVIPYPMLDHCNNMSTM
RASVLKESLDQLVQKEKESPGDLTRSPEMDKLKSVAKCYAYIETSSNPADIDKMTNGETS
SYWQSDGSARSHWIRLKMKPDVVLRHLSIAVAATDQSYMPQQVTVAVGRTAGDLQEVRDV
HIPSNVTGYVTLLENANISQLYVQINIKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDA
SAIWYWSLLTSLVTASMETNPAFVQTVLRNTQKALQHMPPLSLSPGSTDFSTFLSPNVLE
EVDSFLIRITSCRSTPEVELTLLAFALARGSVAKVLSSLCTVTDHLDTHYDASSLISSMA
SVRQNLLLKYGKPLQLTLQACDVKGKEEKSGPENLLAEPWTRDVGFLTETGKTRASTIFS
TGTESAFQVTQIRIMVRRGGIGAQCGLVFAYNSSSDKFHAEEHFKRFEKYDKWKLQEFRQ
FVKSRIGCSSDILGEDDPIGWFELEEEWDEADVKLQQCRVAKYLMVKFLCTRQESAERLG
VQGLSISGYLRPARAEAEQNIVCAHCRKGTEESVCGATLLLKTLQFIQQLAHDLVQQKES
GLKYKSFLDFAGLDLQIFWNFYSKLKQNPREECICAQTLLLQLLQSCFSALQGDAPAATE
DAKAPSPRPRPVEAAEELYAHLCSVVDRLDGDSVPMEILKQEVRNTLLNGAAIFFPDRLT
RRNHLFTMMHVTEQERKQSMQLTFRSLCTYFSDKDPGGLLLLPEKGELADMDISEVLAVM
NTLLSVAARECELLMVDGAQREVGSVLSSLFWSVQGSLLSWCYLQLKSTDSGAKDLAADL
TDRYVGQFLARMRVILESLLSQYSGKTIVEKLCNSVLSMAARQLVIFLLDFCTLDISHCT
LLREFSALTELLKELCSDPDGGVNKLDVETWQQERPVVLHTWTKESAHNYENNCHEVSVF
VSPGATYFEVEFDERCETEKRYDYLEFTDARGGKTRYDTKVGTDKWPKKVTFKAGPRLQF
LFHSDSSNNEWGYKFTVTAYGLPDVAVSWGLDLQLLVSRLMGRLASQCMALKSVHQLGSN
MAVPQAKMALVLNSPLWKPVFRHQIHPELGLEASWPTHPPQDIKEVKNIPDDPCHQFLLD
FAQSDPAQNFCGPYSELFKGFIQACRKQAPKTDIVAGSTIDQAVNATFAALVYRTPDLYE
KLQKYVNSGGKTALSEEFAQVYSLADGIRIWMLEMKQKSLMNLGSEAEDQRGPEAAEANP
ESLDSAKECYQKSLLLLTFLPTGGGSKESCDKSVAVDDTDHLQPLDKRQRTSSVVEEHFQ
ASASPTEAAPPTAGDRSPGPDVQPTLAPSSGPPALEVSSVPAEEPSSPSTPTRRPPFTRG
RLRLLSFRSMEEARPAPTVKEKYPVLKDLMDFIKDQSLSHESVVKVLSLRKAQAWSILEV
LRIIQCCTESLGQPHCFHPPYILFLLELLTCQKEFTNYFGHLEGCGADLHKEIRDTYYQF
VLFLVKAVKGFNSKNDRSLLPALSCIQTALLHLLDMGWEPSDLTFFVDIQLPDLLMKMSQ
ENISAHDSVISQWSEEDELADAKQNSEWMDECQDGMFEAWYEKIAQEDPEKQRKMHMFIA
RYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGVKPEGHGDDHEMVNMEFT
CDHCQGLIIGRRMHCNVCDDFDLCYGCYAAKKYSYGHLPTHSITAHPMVTIRISDRQRLI
QPYIHNYSWLLFAALALYSAHLASAEDVDGEKLDPQVRSSAATLRSRCLQLVGDCLMKAH
QGKGLKALALLGVLPDGGSPPENQALPVTVPTQTSEEQPEKKAVQAAAEPAHAGPAGHRS
GKRDAPKEFRPLDCKQRSKASEGISLRKDPSCLTQISDSPADACTPTGLPDAENSEASSQ
KPIEEKAVIPSPEQVFAECSQKRILGLLAAMLPPLNSDPTVPLIDLEHVLPLMFQVVISN
AGHLNETYHLTLGLLGQLIIRLLPVEVDAAVTKVLSAKHNLFAAGDSSVVPDGWKTTHLL
FSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWRDVVATFTDHCIKQLPFQLKHTNIFTL
LVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFTEKNRAVIVDVKTRKRKTAVKDYQLV
QKGGGQEGSDSQAQLSQYSQHFAFIASHLLQTSMDSHCPEAVEATWVLSLALKGLYKTLK
VHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKEINTLAEHG
ELELDERGDQEEEVERSASSPGDQEQKKLDPLESLDEPTRICFLMAHDALNAPLHILRAI
YELQMKRTDSFFLEVQKRFDGDELTTDERIRTLAQRWQPSRSLRLDEQSAKAVDTDMIIL
PCLSRPVRCEQATVESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSKRAVR
DYLFRVNEATAVLYARHVLASLLAEWPGHVPVSEDILELSGPAHMTYILDMFMQLEDKHQ
WEKILQKVLQGCRENMLGTMALAACQFMEEPGMEVQVRESKHPYNNNTNFEDKVHIPGAI
YLSIKFDPQCNTEEGCDELAMSSSSDFQQDRHNFSGSQQKWKDFELPGDTLYYRFTSDMS
NTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVVPHLPLAKIWEWLVGVACRQTGHQRL
KAIHLLLRIVRCCTHSDLCDLTLLKPLWQLFTQMEYSLFEDVTQAGILLPLHRALTELFF
VTENRAQELGLLQDYLLALTTDDHLLRCAAQALQNIAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences W5QAG0
ENSOARP00000019705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]