SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019781 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019781
Domain Number 1 Region: 407-530
Classification Level Classification E-value
Superfamily Cyclin-like 1.57e-25
Family Cyclin 0.0031
Further Details:      
 
Domain Number 2 Region: 286-404
Classification Level Classification E-value
Superfamily Cyclin-like 8.02e-20
Family Cyclin 0.0026
Further Details:      
 
Domain Number 3 Region: 32-118
Classification Level Classification E-value
Superfamily F-box domain 0.0000000654
Family F-box domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019781   Gene: ENSOARG00000018424   Transcript: ENSOART00000020054
Sequence length 785
Comment pep:known_by_projection chromosome:Oar_v3.1:24:1931108:1952425:1 gene:ENSOARG00000018424 transcript:ENSOART00000020054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGVIHCRCAKCFCYPSKRRIRRRPRNLTILNLPEDALFHILKWLSVGDILAVRAVHS
HLKYLVDNHASVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLRASRYFSLAERLNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQK
THRASILHCLGRVLSLFEDEEKQKQARNLFEESANQGCLTSSYLLWESDRRMDMLDPGRF
LHSFRKLRDFAAKGCWEAQLSLAKACAHRHQLGLEAKASSEIVCHLFQASHAVNKQRVFS
VQKGLNDTMSYVWFGWSVFVRSXKDFSSLCLHLTVECVDRSLQRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALDGKIRVPTVVDYKDVLLTL
VPMAPRTQHLCGFLCELSLLHTSLAAYAPAHLAAAALLLARLTHGQTQPWTTQLWDLTGF
SCEDLIPCVLSLHQKCFHDDAPKDYRQVSLTAVKQRFEDKRYEEISLEEVLSYGQLCAAL
GVKQESLEPAPFLSAGDIHAFLSSPSGRRTKRDQAGPPDNARARFTPPPAAGLSSQEETL
LGSFLDWSLDYCSGYEGDQESEGEKEGDVTAPSGVLDVTVVYLSPEEHCCQESSDEEACP
EEAWGPQDTQAVAPGHQALRTPGPEPPPCSRWGLGKDITTSGYSSVSSASPTDSGHALGG
PPRATSEQSAHRSWYHHHARKSCLQCRPPSPPESCAPQQQVKRKNLSAHSEKEEEEDMNL
GFLKL
Download sequence
Identical sequences W5QAN6
ENSOARP00000019781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]