SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019783 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019783
Domain Number 1 Region: 158-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000904
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 98-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 37-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000734
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019783   Gene: ENSOARG00000018430   Transcript: ENSOART00000020056
Sequence length 234
Comment pep:novel scaffold:Oar_v3.1:JH922639.1:21:2436:-1 gene:ENSOARG00000018430 transcript:ENSOART00000020056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVLCVCSTQHLILCDTNDIYFAMVKYSHSIISIERECSIPQMDAYLNAYPRKDTFKVGD
VLKFSCSQGRIMVGADSVQCYHFGWSPKLPTCKAKKVKGCAPPPQLLNGKGKEIHKEEYA
HNEVVEYACKPRFLMKGSHKIQCVDGRWTALPVCIEEERTCGDIPDLDHGDIKPSVPPYH
HGDSVELSCREAFTMIGPRFITCISGEWTQPPQCIGQNTHLKLTFSICSHTVEI
Download sequence
Identical sequences W5QAN8
XP_011963469.1.66739 ENSOARP00000019783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]