SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019807 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019807
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.17e-118
Family Transglutaminase core 0.0000000000203
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 3.5e-57
Family Transglutaminase N-terminal domain 0.0000000219
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-31
Family Transglutaminase, two C-terminal domains 0.00000341
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.49e-27
Family Transglutaminase, two C-terminal domains 0.00000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019807   Gene: ENSOARG00000018445   Transcript: ENSOART00000020080
Sequence length 732
Comment pep:known_by_projection chromosome:Oar_v3.1:20:47734507:47872375:1 gene:ENSOARG00000018445 transcript:ENSOART00000020080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSETAFGGRRAIPRNTSNAAENDPPTVELQGLVPRGFNPQDYLNVMNVHLFKERWDS
NKVDHHTDKYSNNQLIVRRGQSFYVQIDFNRPYDPRRDFFRVEYVIGRYPQENKGTYIPV
PVVSELQSGKWGAKVVMKEDRSVRLSVQSSPDCIVGKFRMYVAVWTPYGVIRTTRNPETD
TYILFNPWCEEDAVYLDNEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEEGILDTCL
YVMDRANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGIPPSAWTGSVDIL
LEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVETLDTTHIGKLIVTKEIGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKARNTEGVLKSRSDVHMNFEVENAVLGRDLKVIITF
RNNGSTRYTVAAYLSGNISFYTGVSKAEFKNETFNVTLEPLSFKREEVLIGAGEYMGQLL
EQAFLHFFVTARVNETRDVLAKQKSIVLTVPKVIIKVRGAQVVGSDMVVTVEFTNPLKET
LRNVWIRLDGPGVTKPLRRMFREIRPNATVQWEELCRPWVSGPRKLIASLTSDSLRHVYG
ELNLQIQRRPSM
Download sequence
Identical sequences W5QAR2
ENSOARP00000019807 XP_004019193.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]