SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019897 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019897
Domain Number 1 Region: 146-470
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.16e-118
Family Transglutaminase core 0.0000000000406
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily E set domains 1.26e-40
Family Transglutaminase N-terminal domain 0.00000148
Further Details:      
 
Domain Number 3 Region: 477-593
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.54e-32
Family Transglutaminase, two C-terminal domains 0.00000193
Further Details:      
 
Domain Number 4 Region: 594-694
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-28
Family Transglutaminase, two C-terminal domains 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019897   Gene: ENSOARG00000018528   Transcript: ENSOART00000020172
Sequence length 695
Comment pep:known_by_projection chromosome:Oar_v3.1:13:66592413:66621019:-1 gene:ENSOARG00000018528 transcript:ENSOART00000020172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTDLVLERCDLELEVNGCDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AMTGPDPSEETGTKALFRLSDAMEEGAWAAVVVDQQDSTLSLQFSTPANAPIGHYRLSLE
ASTGYQGSSFMLAQFTLLFNSWCPADAVYLNSDEERQEYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLMLLDVNPKFLKNAGRDTPGRACPRRSSPVYVGRVVSGMVNCNDDQG
VLLGRWDNNYGDGISPMFWIGSVDILRRWKEDGCQRVKYGQCWVFAAVACTVLRCLGIPT
RVVTNYNSAHDQNSNLLIEYFRNEYGEQSLWAGKEGAIKNFHCWVESWMTRPDLQPGYEG
WQALDPTPQEKSKGWTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSL
HKSINHSLVVGLKISTKSVGRDDREDITHNYKYPEGSPEEREAFTRANHLNKLVDKEETG
VAMRIRVGEGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSL
SLEPYSEKSIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIR
ILGEPKQNRKLVAEVSLRNPLTEALSGCTFTVEGSGLIEGQKTVDAPDPVEAGEEVKVRV
DLLPLYVGRHKLVVNFESDRLKAVKGFRNVIVGPA
Download sequence
Identical sequences W5QB02
ENSOARP00000019897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]