SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020014 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020014
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Globin-like 1.81e-38
Family Globins 0.000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020014   Gene: ENSOARG00000018639   Transcript: ENSOART00000020291
Sequence length 154
Comment pep:known chromosome:Oar_v3.1:3:178866680:178877963:-1 gene:ENSOARG00000018639 transcript:ENSOART00000020291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE
DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH
PSDFGADAQGAMSKALELFRNDMAAQYKVLGFQG
Download sequence
Identical sequences A6N8S4 C0HJR0 P02190
XP_005680660.1.57651 XP_005977507.1.78601 XP_005977508.1.78601 XP_005977509.1.78601 XP_012015345.1.66739 XP_013819521.1.57651 XP_020739566.1.74333 XP_020739568.1.74333 ENSOARP00000020014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]