SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020088 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020088
Domain Number 1 Region: 275-473
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.19e-46
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 490-565
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.09e-17
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020088
Domain Number - Region: 721-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0444
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020088   Gene: ENSOARG00000018708   Transcript: ENSOART00000020366
Sequence length 811
Comment pep:known_by_projection chromosome:Oar_v3.1:2:207429110:207617538:1 gene:ENSOARG00000018708 transcript:ENSOART00000020366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRGAPPPPAPIRALARAPPCCLLLVLFLLPPLAASSRPRAWGAAAPSAPYWNETAEKKLG
VLADENNTLQQNSSSNSSSSHAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNK
AVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGNIRG
VKDSRVALSTCNGLHGMFEDHTFVYMIEPLDLVHNEKSTGRPHIIQKILAGQYSKQMKNL
SMESSDQWPFLSELQWLKRRRKRAVNPSRGVFEEMKYLELMIVNDHKTYKKCRSSLAHAN
NFAKSVVNLVDSIYKEQLNTRVVLVAVETWTERDHIDITTNLVQMLHEFSKYRQRIRQHA
DAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEP
SSRKPRLECDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLLRGGGACLFNRPTKLFE
PTECGNGYVEAGEECDCGIHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECR
DAVNGCDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGPKASG
SDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPT
SFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSK
GKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGA
ILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences W5QBJ1
ENSOARP00000020088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]