SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020243 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020243
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-16
Family Growth factor receptor domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020243
Domain Number - Region: 111-163
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020243   Gene: ENSOARG00000018846   Transcript: ENSOART00000020523
Sequence length 197
Comment pep:known_by_projection chromosome:Oar_v3.1:13:59435660:59442853:1 gene:ENSOARG00000018846 transcript:ENSOART00000020523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGLGGNCTGCVICSEENGCSTCQQRLFLFIRREGIRQYGKCVHDCPPGYFGVRGQEVNR
CKKCGATCESCFSQDFCIQCKRRFYLYKGKCLPTCPPGTAAQQSTRECQEECELSPWGSW
SPCTHNGKTCGSAWGLETRVRETGRAGREEAATCQVLSESRKCPIRRPCPGERNPNRKKG
QRERRPRKDRKLDGAPA
Download sequence
Identical sequences W5QBZ6
ENSOARP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]