SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020301 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020301
Domain Number 1 Region: 36-205
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.14e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020301   Gene: ENSOARG00000018901   Transcript: ENSOART00000020581
Sequence length 212
Comment pep:known_by_projection chromosome:Oar_v3.1:5:28246200:28259561:1 gene:ENSOARG00000018901 transcript:ENSOART00000020581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGLRPLLPLALCVGLSALVPSAGASGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFG
KVVPKTVENFVALATGEKGYGYKGSTFHRVIKDFMIQGGDFTRGDGTGGISIYGETFPDE
NFRLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQA
TDGHDRPFTNCSIVNSGKIDVKTPFVVEVADW
Download sequence
Identical sequences W5QC54
XP_004008725.1.66739 ENSOARP00000020301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]