SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020326 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020326
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.34e-54
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 234-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020326   Gene: ENSOARG00000018923   Transcript: ENSOART00000020606
Sequence length 720
Comment pep:known_by_projection chromosome:Oar_v3.1:15:64153397:64233464:-1 gene:ENSOARG00000018923 transcript:ENSOART00000020606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGWWPQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIKCECPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVLRVPKGQILLESYPLNAHCEWTIHAKPGFIIQLRIVMLSLEFDYMCQYD
YVEVRDGDSSDSQIIKRFCGNERPAPIRSTGSSLHILFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDSTGSYKCACLAGYTGKHCENLVEERNCSDPGGPVNGYKKITGGPGLI
HGRYAKIGTVLTFFCNSSYVLSGNEMRTCQQNGEWSGKQPICIKACREPKISDLVRRKVL
PVQVQSRETPLHQLYSSAFSKQKLQDAPTKKPVLPFGDLPPGYQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCIPICGKTENVSAPKTQGTRWPWQAAIYRRAGGVHGGGL
HKDAWFLVCSGALVNERTVVVAAHCVTDLGRVTVIKTADLKVVLGKFYRDDDRDEKSIQS
LRISAIILHPNYDPILLDTDIAILKLLDKARISTRIQPICLAAPRDLSTSFQESSITVAG
WNVLADASSPGYKDDTLRSGVVRVADSLLCEEQHEAQGIPVSVTDSMFCASRDPAAPSDI
CTAETGGIAAVSFPGRASPEPRWHLVGLVSWSYDKTCSHSLSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences W5QC79
ENSOARP00000020326 XP_004016455.1.66739 XP_011989578.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]