SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020541 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020541
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.6e-31
Family Canonical RBD 0.00000752
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020541
Domain Number - Region: 499-550
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00576
Family Pentapeptide repeats 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020541   Gene: ENSOARG00000019124   Transcript: ENSOART00000020824
Sequence length 623
Comment pep:novel chromosome:Oar_v3.1:3:11870446:11872317:-1 gene:ENSOARG00000019124 transcript:ENSOART00000020824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIHVTPLIPGKSQTVSGPGPGLCPGPNVLLNQQNPPAPQPQHLARRP
VKDIPPLMQTPIQGGIPPQGPMPAAVPGPGPLTPGGTMQPQVGMPGVGPVPLERGQVQIS
DPRAPMPRGPMTAGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHAA
GHDSRGPSSHEMRGGPLADPRMLMSEPRGPMIDQRGLSMDGRGSRDSRGMETRAMETEVL
ETRVMERRGMETCAMETRGMEARGMDARGMEMRGPGPSSRGPMTGGIQGPGPINMGAGGP
QGPRQVPNISGVGNPGPAMQGAGMQGGGMQGAGMQGPGMQGAGMQGAGMQGAGMQGAGMQ
GPGMQGAGMQGPGWAQSRGKQGGGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAM
LPPEQRQSILILKEQIQKSTGTS
Download sequence
Identical sequences W5QCU3
ENSOARP00000020541 XP_012018612.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]