SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020558 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020558
Domain Number 1 Region: 535-567,642-716
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000569
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020558   Gene: ENSOARG00000019137   Transcript: ENSOART00000020841
Sequence length 748
Comment pep:known_by_projection chromosome:Oar_v3.1:4:44596378:44633290:-1 gene:ENSOARG00000019137 transcript:ENSOART00000020841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILGATHRYYVERPIFSHPVLQERLHKKDKVSDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHVSIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQKKKKFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKR
YSGIFSVVYSTVAVLQNVKNLNVYSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFA
VVMGTGISAGFNLHESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTIS
MAKTLANKHGYQVDGNQMEKELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLA
GCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWL
TTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIP
GIKIFQINAPIYYANSDLYSNALKRKTGVNPAFIMGARRKAVRKYAKEVGNANMASVTVV
KVDAEVDGEDGTKPEEDENEIKYPPIVIKSTLPEELQRFMPPGDNIHTIILDFTQVNFID
SVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALLELLFHSIHDAVLGS
QAREALAEQEGSAVPPQEDSEPNATPEA
Download sequence
Identical sequences W5QCW0
ENSOARP00000020558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]