SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020568 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020568
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 6.96e-49
Family Globins 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020568   Gene: ENSOARG00000019144   Transcript: ENSOART00000020851
Sequence length 143
Comment pep:novel chromosome:Oar_v3.1:15:47553135:47554285:1 gene:ENSOARG00000019144 transcript:ENSOART00000020851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVEEKDTVIAFWSWVRVDEVGAETLGRLLVVYPWTQRFFEHFGDLSNADAVMNNPKVKAH
GKKVLDSFTKGLKHLHRLKRFFAALSELHCEKLHVNPENFKLLGNILVITLARHFGKEFT
PELQAACQKVVAVVVNALTDRYC
Download sequence
Identical sequences W5QCX0
ENSOARP00000020568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]